
Sodium channel beta-subunit 4, also known as SCN4B, is a protein that in humans is encoded by the SCN4B gene. The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.
Optimal dilution of the SCN4B antibody should be determined by the researcher.
Amino acids LRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ from the human protein were used as the immunogen for the SCN4B antibody.
After reconstitution, the SCN4B antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.