
This gene is mapped to 3q26.1. It encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.
Optimal dilution of the Sucrase Isomaltase antibody should be determined by the researcher.
Amino acids FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID were used as the immunogen for the Sucrase Isomaltase antibody.
After reconstitution, the Sucrase Isomaltase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.