>
产品中心 >
monoclonal_antibody >
NSJ Bio/MOG Antibody / Myelin Oligodendrocyte Glycoprotein (RQ4651)/100 ug/RQ4651

Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS). In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary adhesion molecule to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
Optimal dilution of the MOG antibody should be determined by the researcher.
Amino acids RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK were used as the immunogen for the MOG antibody.
After reconstitution, the MOG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.