
Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to 20p13. This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.
Optimal dilution of the Doppel antibody should be determined by the researcher.
Amino acids ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH were used as the immunogen for the Doppel antibody.
After reconstitution, the Doppel antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.