Mucosal Vascular Addressin Cell Adhesion Molecule 1 is a protein that in humans is encoded by the MADCAM1 gene. By PCR-based analysis of somatic cell hybrids, Leung et al.(1997) mapped the gene to chromosome 19. The protein encoded by this gene is an endothelil cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1(alpha4 / beta7), L-selectin, and VLA-4(alpha4/beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin superfamily and is similar to ICAM-1 and VCAM-1.

The stated application concentrations are suggested starting amounts.Titration of the MADCAM1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Amino acids QELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRL were used as the immunogen for this MADCAM1 antibody.

After reconstitution, the MADCAM1 antibody can be stored for up to one month at4oC.For long-term, aliquot and store at -20oC.Avoid repeated freezing and thawing.