
Transcription factor JunD is a protein that in humans is encoded by the JUND gene. The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms.
Optimal dilution of the JUND antibody should be determined by the researcher.1, The short form of the protein lacks the N-terminal 43 amino acids.
Amino acids TASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY from the human protein were used as the immunogen for the JUND antibody.
After reconstitution, the JUND antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.