>
产品中心 >
monoclonal_antibody >
NSJ Bio/DNA Polymerase iota Antibody / POLI (RQ4298)/100 ug/RQ4298

DNA polymerase iota is an enzyme that in humans is encoded by the POLI gene. The protein encoded by this gene is an error-prone DNA polymerase involved in DNA repair. The encoded protein promotes DNA synthesis across lesions in the template DNA, which other polymerases cannot do. The encoded polymerase inserts deoxynucleotides across lesions and then relies on DNA polymerase zeta to extend the nascent DNA strand to bypass the lesion.
Optimal dilution of the DNA Polymerase iota antibody should be determined by the researcher.
Amino acids DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK were used as the immunogen for the DNA Polymerase iota antibody.
After reconstitution, the DNA Polymerase iota antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.