>
产品中心 >
monoclonal_antibody >
NSJ Bio/THBS2 Antibody / Thrombospondin 2 (RQ4469)/100 ug/RQ4469

Thrombospondin-2 (THBS2) is a protein that in humans is encoded by the THBS2 gene. The protein encoded by this gene belongs to the thrombospondin family. The THBS2 is mapped to 6q27 and it is located on chromosome 17. The gene was transcribed in fibroblasts, smooth muscle cells, and an osteosarcoma cell line. It functions as a protein inhibitor of tumor growth and angiogenesis and modulates the cell surface properties of mesenchymal cells and be involved in cell adhesion and migration.
Optimal dilution of the THBS2 antibody should be determined by the researcher.
Amino acids DHVKDTSFDLFSISNINRKTIGAKQFRGPD were used as the immunogen for the THBS2 antibody.
After reconstitution, the THBS2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.