>
产品中心 >
Functional_antibody >
NSJ Bio/PCDH15 Antibody / Protocadherin 15 (RQ4652)/100 ug/RQ4652

Protocadherin-15 is a protein that in humans is encoded by the PCDH15 gene. This geneis mapped to 10q21.1. This gene is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). Extensive alternative splicing resulting in multiple isoforms has been observed in the mouse ortholog. Similar alternatively spliced transcripts are inferred to occur in human, and additional variants are likely to occur.
Optimal dilution of the PCDH15 antibody should be determined by the researcher.
Amino acids DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ were used as the immunogen for the PCDH15 antibody.
After reconstitution, the PCDH15 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.