>
产品中心 >
monoclonal_antibody >
NSJ Bio/ACTN3 Antibody / Alpha Actinin 3 [clone 9B5] (RQ4625)/100 ug/RQ4625
![NSJ Bio/ACTN3 Antibody / Alpha Actinin 3 [clone 9B5] (RQ4625)/100 ug/RQ4625](https://www.ebiomall.cn/images/NSJ/img-RQ4625-1.jpg)
Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
Optimal dilution of the ACTN3 antibody should be determined by the researcher.
Amino acids EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK were used as the immunogen for the ACTN3 antibody.
After reconstitution, the ACTN3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.