>
产品中心 >
Functional_antibody >
NSJ Bio/Cytokeratin 19 Antibody [clone 3D4] (RQ4521)/100 ug/RQ4521
![NSJ Bio/Cytokeratin 19 Antibody [clone 3D4] (RQ4521)/100 ug/RQ4521](https://www.ebiomall.cn/images/NSJ/img-RQ4521-1.jpg)
Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.
Optimal dilution of the Cytokeratin 19 antibody should be determined by the researcher.
Amino acids QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR were used as the immunogen for the Cytokeratin 19 antibody.
After reconstitution, the Cytokeratin 19 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.