
Signal transducer and activator of transcription 2 is a protein that in humans is encoded by the STAT2 gene. The protein encoded by this gene is a member of the STAT protein family. The International Radiation Hybrid Mapping Consortium mapped the STAT2 gene to chromosome 12. STAT2 is a transcription factor critical to the signal transduction pathway of type I interferons. ISGF3 (STAT2) assembly involves p48 functioning as an adaptor protein to recruit Stat1 and Stat2 to an IFN-alpha-stimulated response element, Stat2 contributes a potent transactivation domain but is unable to directly contact DNA, while Stat1 stabilizes the heteromeric complex by contacting DNA directly.
Optimal dilution of the STAT2 antibody should be determined by the researcher.
Amino acids FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA were used as the immunogen for the STAT2 antibody.
After reconstitution, the STAT2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.