![NSJ Bio/NFIA Antibody [clone 16H11] (RQ4923)/100 ug/RQ4923](https://www.ebiomall.cn/images/NSJ/img-RQ4923-1.jpg)
Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiplegenes, differential splicing, and heterodimerization.
Optimal dilution of the NFIA antibody should be determined by the researcher.
Amino acids AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS from the human protein were used as the immunogen for the NFIA antibody.
After reconstitution, the NFIA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.