![NSJ Bio/ASXL1 Antibody [clone 11I4] (RQ6024)/100 ug/RQ6024](https://www.ebiomall.cn/images/NSJ/img-RQ6024-1.jpg)
Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.
Optimal dilution of the ASXL1 antibody should be determined by the researcher.
Amino acids KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE from the human protein were used as the immunogen for the ASXL1 antibody.
After reconstitution, the ASXL1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.