![NSJ Bio/Msi1 Antibody / Musashi 1 [clone 2B9] (RQ5670)/100 ug/RQ5670](https://www.ebiomall.cn/images/NSJ/img-RQ5670-1.jpg)
RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
Optimal dilution of the Msi1 antibody should be determined by the researcher.
Amino acids KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD from the human protein were used as the immunogen for the Msi1 antibody.
After reconstitution, the Msi1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.