![NSJ Bio/EEF2 Antibody / Elongation factor 2 [clone 5F5] (RQ6234)/100 ug/RQ6234](https://www.ebiomall.cn/images/NSJ/img-RQ6234-1.jpg)
Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.
Optimal dilution of the EEF2 antibody should be determined by the researcher.
Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the EEF2 antibody.
After reconstitution, the EEF2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.