
Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.
Optimal dilution of the Elongation factor 2 antibody should be determined by the researcher.
Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the Elongation factor 2 antibody.
After reconstitution, the Elongation factor 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.