MORC family CW-type zinc finger protein 3 is a protein that in humans is encoded by the MORC3 gene. This gene is mapped to 21q22.12. This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms.

Optimal dilution of the MORC3 antibody should be determined by the researcher.

Amino acids ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD from the human protein were used as the immunogen for the MORC3 antibody.

After reconstitution, the MORC3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.