
APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.
Differences in protocols and secondary/substrate sensitivity may require the APC2 antibody to be titrated for optimal performance.
Amino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein were used as the immunogen for the APC2 antibody.
After reconstitution, the APC2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.