
Breast cancer anti-estrogen resistance protein 3 is a protein that in humans is encoded by the BCAR3 gene. Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. BCAR3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. Multiple transcript variants encoding different isoforms have been found for this gene.
Optimal dilution of the BCAR3 antibody should be determined by the researcher.
Amino acids KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL of human BCAR3 were used as the immunogen for the BCAR3 antibody.
After reconstitution, the BCAR3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.