
Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.
Differences in protocols and secondary/substrate sensitivity may require the BDKRB2 antibody to be titrated for optimal performance.
Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody.
After reconstitution, the BDKRB2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.