
BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily.BMP-2, like otherbone morphogenetic proteins,plays an important role in the development of bone and cartilage. It is involved in thehedgehog pathway,TGF beta signaling pathway, and incytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation andepithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.
Optimal dilution of the BMP2 antibody should be determined by the researcher.
Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody.
After reconstitution, the BMP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.