The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-kB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin"s lymphoma.
Optimal dilution of the c-Rel antibody should be determined by the researcher.
Amino acids DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD of mouse c-Rel were used as the immunogen for the c-Rel antibody.
After reconstitution, the c-Rel antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
