
Copper chaperone for superoxide dismutase (CCS, SOD4) is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.
Optimal dilution of the CCS antibody should be determined by the researcher.
Amino acids 174-209 (DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR) from the human protein were used as the immunogen for the CCS antibody.
After reconstitution, the CCS antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.