
Gap junction beta-1 protein (GJB1), also known as Connexin 32 (Cx32) is a transmembrane protein that in humans is encoded by the GJB1 gene. This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Optimal dilution of the Connexin 32 antibody should be determined by the researcher.
Amino acids AMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVH were used as the immunogen for the Connexin 32 antibody.
After reconstitution, the Connexin 32 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.