
This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And this gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.
Optimal dilution of the Cryptochrome I antibody should be determined by the researcher.
Amino acids FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK of human Cryptochrome I were used as the immunogen for the Cryptochrome I antibody.
After reconstitution, the Cryptochrome I antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.