
DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney.
Optimal dilution of the DDAH1 antibody should be determined by the researcher.
Amino acids QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN were used as the immunogen for the DDAH1 antibody.
Prior to reconstitution, store at 4oC. After reconstitution, the DDAH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.