
DDAH2 is known as dimethylarginine dimethylaminohydrolase 2 which is mapped to 6p21.3 by radiation hybrid and FISH analysis. This gene encodes a dimethylarginine dimethylaminohydrolase. DDAH2 functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants.
Optimal dilution of the DDAH2 antibody should be determined by the researcher.
Amino acids DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR were used as the immunogen for the DDAH2 antibody.
Prior to reconstitution, store at 4oC. After reconstitution, the DDAH2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.