>
产品中心 >
monoclonal_antibody >
NSJ Bio/DHODH Antibody / Dihydroorotate dehydrogenase (R32524)/100 ug/R32524

Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
Differences in protocols and secondary/substrate sensitivity may require the DHODH antibody to be titrated for optimal performance.
Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody.
After reconstitution, the DHODH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.