Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration. [UniProt]
Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.
Optimal dilution of the Fascin antibody should be determined by the researcher.
Amino acids KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD of human Fascin were used as the immunogen for the Fascin antibody.
After reconstitution, the Fascin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

