>
产品中心 >
Functional_antibody >
NSJ Bio/GRIN1 Antibody / NMDAR1 / NR1 (RQ4092)/100 ug/RQ4092

Glutamate [NMDA] receptor subunit zeta-1 is a protein that in humans is encoded by the GRIN1 gene. The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.
Optimal dilution of the GRIN1 antibody should be determined by the researcher.
Amino acids FIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRK from the human protein were used as the immunogen for the GRIN1 antibody.
After reconstitution, the GRIN1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.