>
产品中心 >
Functional_antibody >
NSJ Bio/HSP90 alpha Antibody / HSP90AA1 (R31907)/100 ug/R31907
Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.
Optimal dilution of the HSP90 alpha antibody should be determined by the researcher.
Amino acids QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ of human HSP90AA1 were used as the immunogen for the HSP90 alpha antibody.
After reconstitution, the HSP90 alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

