>
产品中心 >
monoclonal_antibody >
NSJ Bio/ICA1 Antibody / Islet cell autoantigen 1 (R32190)/100 ug/R32190

Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What"s more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren"s syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
Optimal dilution of the ICA1 antibody should be determined by the researcher.
Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.
After reconstitution, the ICA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.