>
产品中心 >
monoclonal_antibody >
NSJ Bio/IL6R Antibody (C-Terminal Region) (R32900)/100 ug/R32900

Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.
Optimal dilution of the IL6R antibody should be determined by the researcher.
Amino acids 379-419 (LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR) were used as the immunogen for the IL6R antibody.
After reconstitution, the IL6R antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.