
Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene. It is mapped to 13q34. This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Optimal dilution of the ING1 antibody should be determined by the researcher.
Amino acids KELDECYERFSRETDGAQKRRMLHCVQRALIR of human Inhibitor of growth protein 1 were used as the immunogen for the ING1 antibody.
After reconstitution, the ING1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.