>
产品中心 >
monoclonal_antibody >
NSJ Bio/Integrin alpha 4 Antibody / ITGA4 (R31960)/100 ug/R31960

ITGA4/Integrin alpha4 is an integrin alpha subunit. It makes up half of the alpha4beta1 lymphocyte homing receptor. The product of this gene belongs to the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. ITGA4 is also mapped to 2q31-q32 by fluorescence in situ hybridization.
Optimal dilution of the Integrin alpha 4 antibody should be determined by the researcher.
Amino acids MWKAGFFKRQYKSILQEENRRDSWSYINSK of human ITGA4 were used as the immunogen for the Integrin alpha 4 antibody.
After reconstitution, the Integrin alpha 4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.