>
产品中心 >
monoclonal_antibody >
NSJ Bio/KCNH1 Antibody / EAG1 (C-Terminal Region) (RQ4065)/100 ug/RQ4065

Potassium voltage-gated channel subfamily H member 1 is a protein that in humans is encoded by the KCNH1 gene. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms.
Optimal dilution of the KCNH1 antibody should be determined by the researcher.
Amino acids AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA from the human protein were used as the immunogen for the KCNH1 antibody.
After reconstitution, the KCNH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.