
Lysine-specific demethylase 5B, also known as histone demethylase JARID1B, is a demethylase enzyme that in humans is encoded by the KDM5B gene. This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing resultsi n multiple transcript variants.
Differences in protocols and secondary/substrate sensitivity may require the KDM5B antibody to be titrated for optimal performance.
Amino acids 641-685 (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL) from the human protein were used as the immunogen for the KDM5B antibody.
After reconstitution, the KDM5B antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.