Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea.
Optimal dilution of the Keratocan antibody should be determined by the researcher.
Amino acids YLQNNLIETIPEKPFENATQLRWINLNKNKITN of human Keratocan were used as the immunogen for the Keratocan antibody.
After reconstitution, the Keratocan antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

