>
产品中心 >
Functional_antibody >
NSJ Bio/LIMK2 Antibody / LIM Kinase 2 (R32136)/100 ug/R32136

LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene.
Optimal dilution of the LIMK2 antibody should be determined by the researcher.
Amino acids KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD of human LIM Kinase 2 were used as the immunogen for the LIMK2 antibody.
After reconstitution, the LIMK2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.