>
产品中心 >
Functional_antibody >
NSJ Bio/MAK Antibody (C-Terminal Region) (R32835)/100 ug/R32835

Serine/threonine-protein kinase MAK (Male germ cell-associated kinase) is an enzyme that in humans is encoded by the MAK gene. The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62.
Optimal dilution of the MAK antibody should be determined by the researcher.
Amino acids 588-623 (RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR) were used as the immunogen for the MAK antibody.
After reconstitution, the MAK antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.