
Melanocortin receptor 3 is a protein that in humans is encoded by the MC3R gene. It is mapped to 20q13.2. This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.
Optimal dilution of the MC3 Receptor antibody should be determined by the researcher.
Amino acids 91-121 (NALETIMIAIVHSDYLTFEDQFIQHMDNIFD) from the human protein were used as the immunogen for the MC3 Receptor antibody.
After reconstitution, the MC3 Receptor antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.