>
产品中心 >
Functional_antibody >
NSJ Bio/MEFV Antibody / Marenostrin / Pyrin (R31814)/100 ug/R31814
MEFV (Mediterranean fever) is a human gene that provides instructions for making a protein called pyrin (also known as marenostrin). Pyrin is produced in certain white blood cells (neutrophils, eosinophils and monocytes) that play a role in inflammation and in fighting infection. Inside these white blood cells, pyrin is found with thecytoskeleton, the structural framework that helps to define the shape, size, and movement of a cell. Pyrin"s protein structure also allows it to interact with other molecules involved in fighting infection and in the inflammatory response. Although pyrin"s function is not fully understood, it likely assists in keeping the inflammation process under control. Research indicates that pyrin helps regulate inflammation by interacting with the cytoskeleton. And Pyrin may direct the migration of white blood cells to sites of inflammation and stop or slow the inflammatory response when it is no longer needed.
Optimal dilution of the MEFV antibody should be determined by the researcher.
Amino acids PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR of human MEFV were used as the immunogen for the MEFV antibody.
After reconstitution, the MEFV antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

