
NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (N-alpha-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE.
Optimal dilution of the NARG1 antibody should be determined by the researcher.
Amino acids 244-287 (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY) from the human protein were used as the immunogen for the NARG1 antibody.
After reconstitution, the NARG1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.