The bile acid receptor (BAR), also known as farnesoid X receptor (FXR) or NR1H4 (nuclear receptor subfamily 1, group H, member 4) is a nuclear receptor that is encoded by the NR1H4 gene in humans. This gene encodes a ligand-activated transcription factor that shares structural features in common with nuclear hormone receptor family members. This protein functions as a receptor for bile acids, and when bound to bile acids, binds to DNA and regulates the expression of genes involved in bile acid synthesis and transport.

Optimal dilution of the NR1H4 antibody should be determined by the researcher.

Amino acids 442-486 (QHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ) were used as the immunogen for the NR1H4 antibody.

After reconstitution, the NR1H4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.