>
产品中心 >
monoclonal_antibody >
NSJ Bio/P2RY5 Antibody / P2Y Purinoceptor 5 / LPAR6 (RQ4219)/100 ug/RQ4219

Lysophosphatidic acid receptor 6 also known as LPA6, P2RY5, and GPR87, is a protein that in humans is encoded by the LPAR6 gene. The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants.
Optimal dilution of the P2RY5 antibody should be determined by the researcher.
Amino acids DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK were used as the immunogen for the P2RY5 antibody.
After reconstitution, the P2RY5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.