Protease activated receptor 2 (PAR2), also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.

Optimal dilution of the PAR2 antibody should be determined by the researcher.

Amino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody.

After reconstitution, the PAR2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.