
Progesterone receptor membrane component 1 is a protein which co-purifies with progesterone binding proteins in the liver and ovary. In humans, the protein is encoded by the PGRMC1 gene. The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1. The sole biochemical function of PGRMC1 is heme-binding. PGRMC1 shares key structural motifs with cytochrome b5. It binds and activates P450 proteins, which are important in drug, hormone and lipid metabolism. Also, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding protein-1). However, its expression outside of the reproductive tract and in males suggests multiple functions for the protein. These may include binding to Insig (insulin-induced gene), which regulates cholesterol synthesis.
Optimal dilution of the PGRMC1 antibody should be determined by the researcher.
Amino acids RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK of the human protein were used as the immunogen for the PGRMC1 antibody.
After reconstitution, the PGRMC1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.