UchL1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UchL1/PGP9.5 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UchL1/PGP9.5 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.
Optimal dilution of the PGP 9.5 antibody should be determined by the researcher.
Amino acids ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR of human PGP9.5 were used as the immunogen for the PGP 9.5 antibody.
After reconstitution, the PGP 9.5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

