>
产品中心 >
monoclonal_antibody >
NSJ Bio/PI3K p110 Antibody (beta) / PIK3CB (R32723)/100 ug/R32723

Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform is an enzyme that in humans is encoded by the PIK3CB gene. This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants.
Optimal dilution of the PI3K p110 antibody should be determined by the researcher.
Amino acids 556-598 (DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW) from the human protein were used as the immunogen for the PI3K p110 antibody.
After reconstitution, the PI3K p110 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.